PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G118800.1.p
Common NameGLYMA_15G118800, Glyma15g12570.1, LOC100778034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 172aa    MW: 18978.2 Da    PI: 6.6281
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G118800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.81.6e-5825120297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdrflPianvsrimkk+lPanakisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfe+yveplkvyl+kyr
  Glyma.15G118800.1.p  25 REQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEEYVEPLKVYLHKYR 114
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          elegek
  Glyma.15G118800.1.p 115 ELEGEK 120
                          ****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-5522132IPR009072Histone-fold
SuperFamilySSF471139.32E-4227132IPR009072Histone-fold
PfamPF008083.4E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-215876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.7E-217795No hitNo description
PRINTSPR006151.7E-2196114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MAESDNESGG HTGNASGSNE FSGCREQDRF LPIANVSRIM KKALPANAKI SKEAKETVQE  60
CVSEFISFIT GEASDKCQKE KRKTINGDDL LWAMTTLGFE EYVEPLKVYL HKYRELEGEK  120
TAMMGRPHER DEGYGHATPM MIMMGHQQQQ HQGHVYGSGT TTGSASSART R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4825115292Transcription factor HapC (Eurofung)
4g92_B1e-4825115292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.363520.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311580.0KT031158.1 Glycine max clone HN_CCL_197 CCAAT transcription factor (Glyma15g12570.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003546199.11e-128PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233102e-73NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0B2RM511e-127A0A0B2RM51_GLYSO; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0K2CT951e-127A0A0K2CT95_SOYBN; CCAAT transcription factor (Fragment)
STRINGGLYMA15G12570.11e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.18e-74nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]